Microbes and Infection 17 (2015) 402e408 www.elsevier.com/locate/micinf

Original article

Chlamydia-secreted protease CPAF degrades host antimicrobial peptides Lingli Tang a,b, Jianlin Chen a,c, Zhiguang Zhou d, Ping Yu e, Zhangsheng Yang a, Guangming Zhong a,* a

Department of Microbiology and Immunology, University of Texas Health Science Center at San Antonio, 7703 Floyd Curl Drive, San Antonio, TX 78229, USA b Department of Clinic Diagnosis, Second Xiangya Hospital, Central South University, Changsha, Hunan, China c Department of Obstetrics and Gynecology, Second Xiangya Hospital, Central South University, Changsha, Hunan, China d Department of Endocrinology, Second Xiangya Hospital, Central South University, Changsha, Hunan, China e Department of Immunology, Xiangya School of Medicine, Central South University, Changsha, Hunan, China Received 5 February 2015; accepted 26 February 2015 Available online 6 March 2015

Abstract Chlamydia trachomatis infection in the lower genital tract, if untreated, can ascend to the upper genital tract, potentially leading to complications such as tubal factor infertility. The ascension involves cell-to-cell spreading, which may require C. trachomatis organisms to overcome mucosal extracellular effectors such as antimicrobial peptides. We found that among the 8 antimicrobial peptides tested, the cathelicidin LL-37 that is produced by both urogenital epithelial cells and the recruited neutrophils possessed a most potent antichlamydial activity. Interestingly, this antichlamydial activity was completely inhibited by CPAF, a C. trachomatis-secreted serine protease. The inhibition was dependent on CPAF's proteolytic activity. CPAF selectively degraded LL-37 and other antimicrobial peptides with an antichlamydial activity. CPAF is known to secrete into and accumulate in the infected host cell cytoplasm at the late stage of chlamydial intracellular growth and may be released to confront the extracellular antimicrobial peptides before the intra-inclusion organisms are exposed to extracellular environments during host cell lysis and chlamydial spreading. Thus, the finding that CPAF selectively targets host antimicrobial peptides that possess antichlamydial activities for proteolysis suggests that CPAF may contribute to C. trachomatis pathogenicity by aiding in ascending infection. © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

Keywords: Chlamydia trachomatis; CPAF; Proteolysis of antimicrobial peptides

1. Introduction There are more than one million new Chlamydia trachomatis infections every year in the US [3], some of which, if untreated, can ascend to the upper genital tract and causes complications such as pelvic inflammatory diseases, ectopic pregnancy and infertility [29]. The C. trachomatis ability to undergo intracellular replication and intercellular spreading is thought to significantly contribute to C. trachomatis pathogenicity [41,8,9]. The C. trachomatis organisms initiate their intracellular infection by invading epithelial cells in the form

* Corresponding author. Tel.: þ1 210 567 1169; fax: þ1 210 567 0293. E-mail address: [email protected] (G. Zhong).

of elementary bodies (EBs). Once internalized, the intracellular EBs rapidly differentiate into reticulate bodies (RBs) for replication. The progeny RBs have to differentiate back into EBs for exiting the infected cells and spreading to new cells. The intracellular life of C. trachomatis organisms occurs strictly inside cytoplasmic vacuoles termed inclusions, during which, the intra-inclusion chlamydial organisms secrete numerous proteins into host cell cytoplasm [2,7,43], including a unique serine protease designated as chlamydial proteasome/ protease-like activity factor or CPAF [44,23]. However, the function and significance of these secreted proteins in chlamydial biology and pathogenesis remain largely unknown [14,31,36,42,30]. For example, CPAF was initially thought to degrade various intracellular targets for aiding in chlamydial evasion of host defense [46,43,45]. However, a recent study

http://dx.doi.org/10.1016/j.micinf.2015.02.005 1286-4579/© 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

L. Tang et al. / Microbes and Infection 17 (2015) 402e408

has shown that degradation of the intracellular targets may be an artifact produced during sample processing [4]. Then, what is the authentic target(s) of CPAF if not intracellular molecules? It is known that C. trachomatis organisms can ascend from lower to upper genital tracts and cause upper genital tract pathologies. Although it is obvious that ascending infection may require chlamydial organisms to spread from cells to cells, the precise mechanisms of ascending infection remain unknown. It has been recently reported that C. trachomatis organisms can spread via either cell lysis or inclusion extrusion mechanisms [24]. In both cases, C. trachomatis organisms have to undergo an extracellular phase and expose to mucosal extracellular environments where abundant host immune effectors such as antimicrobial peptides can readily attack chlamydial organisms. For example, it has been shown that various antimicrobial peptides including the cathelicidin LL-37 can potently inhibit chlamydial infection and antimicrobial peptides are produced in response to chlamydial infection [34,22]. The fact that C. trachomatis can ascend from lower to upper genital tracts suggests that C. trachomatis has possessed the ability to overcome the extracellular immune effectors in the urogenital tract mucosa. The question is whether C. trachomatis can use CPAF molecules pre-stored in the cytoplasm of the infected cells to proteolytically target the extracellular defense effector molecules. Human antimicrobial peptides represent a large group of cationic peptides that possess antimicrobial activities, including human alpha-defensins (HADs) or human neutrophil peptides (HNPs), human beta-defensins (HBDs) and cathelicidin LL-37 [28,1,20,10]. LL-37 is a C-terminal 37 amino acid peptide starting with double leucines (LL) processed from human cationic antimicrobial protein 18 (hCAP, 18 kDa) that contains a highly conserved amino terminal cathelin-like domain and a variable carboxyl terminal domain [28,20]. HNPs are mainly produced by neutrophils while HBDs by epithelial cells. Interestingly, both epithelial cells including those in the genital tract and the recruited neutrophils can produce and release LL-37. These extracellular antimicrobial peptides possess a broad spectrum of antibacterial activity by inducing pore formation in bacterial membrane and represent a powerful first line of defense [27,20]. The strong antibacterial activity of antimicrobial peptides has selected many bacterial species to evolve countermeasures for evading the antimicrobial peptides [12,35,39]. For example, LL-37 is targeted for degradation by SufA, a serine protease of Finegoldia magna [25], streptopain of Streptococcus pyogenes, elastase of Pseudomonas aeruginosa, gelatinase of Enterococcus feacalis and the 50 kDa metalloprotease (ZapA) of Proteus mirabilis [39]. The C. trachomatis organisms produce a unique serine protease CPAF that is further secreted into and accumulated in the cytoplasm of the infected cells at the late stage of chlamydial intracellular growth [44,23]. Since C. trachomatis organisms have to overcome antichlamydial activity of extracellular antimicrobial peptides in the genital tract mucosal tissues during ascending infection, we hypothesize

403

that CPAF stored in the cytoplasm of Chlamydia-infected cells may be released to degrade extracellular antimicrobial peptides before the intra-inclusion organisms are exposed to the extracellular environment during host cell lysis and chlamydial spreading. To test the hypothesis, we re-evaluated the antichlamydial activity of 8 human antimicrobial peptides and found that LL-37 displayed the strongest ability for inhibiting chlamydial infection. Then, we evaluated the effect of CPAF on LL-37 antichlamydial activity and found that CPAF can potently block the LL-37 antichlamydial activity and restore chlamydial infection. We further found that the blockade was due to CPAF's ability to efficiently degrade LL-37. Thus, we have revealed a novel mechanism on how C. trachomatis organisms can use the serine protease CPAF pre-stored in the host cell cytoplasm for evading extracellular immune effectors, which may benefit chlamydial spreading and promote chlamydial pathogenicity. 2. Materials and methods 2.1. Cell culture and chlamydial infection HeLa cells (human cervical carcinoma epithelial cells, ATCC cat# CCL2) and C. trachomatis L2/LGV-434/Bu and serovar D/UW3 organisms (both from ATCC) were used in the current study. The chlamydial organisms were propagated, purified, aliquoted and stored as described previously [44]. For infection, HeLa cells grown in either multiple well plates/tissue culture dishes/flasks were inoculated with chlamydial organisms as described previously [44]. The cultures were processed for immunofluorescence assays as described below. 2.2. Immunofluorescence assay The immunofluorescence assay was carried out as described previously [19]. C. trachomatis-infected HeLa cells grown on coverslips in 24 well plates were fixed with 2% paraformaldehyde (Sigma, St. Luis, MO) dissolved in PBS for 1 h at room temperature, followed by permeabilization with 2% saponin (Sigma) for an additional 1 h. After washing and blocking, the cell samples were subjected to antibody and chemical staining. Hoechst (blue, Sigma) was used to visualize DNA. A rabbit anti-chlamydial organism antibody (raised with C. trachomatis D organisms, unpublished data), plus a goat antirabbit IgG secondary antibody conjugated with Cy2 (green; Jackson ImmunoResearch Laboratories, Inc., West Grove, PA) was used to visualize chlamydial inclusions under a fluorescence microscope. For quantitating chlamydial infection, five random views were counted from each coverslip and the results were expressed as average number of IFUs per view. 2.3. IC50 titration To obtain IC50 (minimal concentrations required for inhibiting 50% chlamydial infection) for human antimicrobial peptides, each peptide was serially diluted and incubated with chlamydial organisms in 200 ml of SPG at room temperature

404

L. Tang et al. / Microbes and Infection 17 (2015) 402e408

for 2 h. The incubation mixtures were then inoculated onto HeLa cell monolayer. Forty-eight hours after infection, chlamydial inclusions were visualized using an immunofluorescence assay as described above. The chlamydial infection was quantitated by counting 5 random views for each coverslip and the results were expressed as number of inclusion forming units (IFUs) per view. Based on the IFUs per view and concentrations of antimicrobial peptides used, a 50% of inhibition concentration was calculated for each antimicrobial peptide using an online IC50 calculation software (http://www.dxy.cn/ bbs/topic/2987601). The titration was repeated 3 to 4 times with duplicates in each experiment. The final IC50 for each antimicrobial peptide was expressed as mean plus/minus standard deviation. For titrating IC50 of antimicrobial peptides against E. coli, serially diluted antimicrobial peptides were mixed with E. coli XL1-Blue (Stratagene, La Jolla, CA) in 100 ml of PBS with shaking at 37  C for 2 h. The incubation mixtures were plated on LB plates. The E. coli was pre-titrated so that the amount of E. coli used in the IC50 titration can form about 500e1000 colonies per plate in the absence of any antimicrobial peptides. After overnight culture at 37  C, the number of colonies per plate was counted and the concentration of each antimicrobial peptide required for achieving 50% inhibition was calculated. As with the titration of antichlamydial activity, the anti-E. coli activity was repeated 3e4 times with duplicates in each experiment and the final results were expressed as mean plus/minus standard deviation. The following antimicrobial peptides were used in the current study: HNP1 (human neutrophil peptide 1 or human alphadefensin 1, cat# 60743), HNP2 (cat# 60744, both from AnaSpec, Fremont, CA), HNP3 (cat# PDF-4416-s), HBD1 (human beta-defensin 1, cat# PDF-4337-s), HBD2 (cat# PDF4338-s), HBD3 (cat# PDF-4382-s) & HBD4 (cat# PDF-4406s, all 5 are from Peptides International, Louisville, Kentucky) and LL-37 (cat# 61302 with a sequence of [LL-37, 37 aa], AnaSpec or Peptide 2.0, Chantilly, VA). 2.4. Cell-free pre-incubation assay A cell-free pre-incubation assay was used to measure both CPAF blockade of antichlamydial activity and CPAF degradation of antimicrobial peptides. Recombinant wild type (WT) CPAF or mutant CPAF carrying substitution of the catalytic residue glutamic acid (E) at the position of 558 with alanine (E558A, ref: [5,23]) at varying concentrations were preincubated with each antimicrobial peptide in SPG {sucrosephosphate-glutamic acid buffer, containing (per liter) 75 g of sucrose, 0.52 g of KH2PO4, 1.22 g of Na2HPO4 & 0.72 g of glutamic acid} or PBS (phosphate-buffered saline solution, pH 7.4) at 37  C for various periods of time as indicated in individual experiments. For blocking antichlamydial activity of antimicrobial peptides, the pre-incubation was in 200 ml SPG and each pre-incubation mixture was used to treat chlamydial organisms prior to infecting HeLa cells. For monitoring the degradation of antimicrobial peptides, the pre-incubation was in 10 ml PBS and the pre-incubation mixtures were loaded

onto a 17% SDS polyacrylamide gel. After electrophoresis separation, the gel was stained with a Coomassie blue dye (Sigma, MO) for visualizing protein bands. 3. Results 3.1. Antichlamydial activity of human antimicrobial peptides We compared 8 human antimicrobial peptides including alpha-defensin-1 to 3, beta-defensin-1 to 4 and the cathelicidin LL-37 for their ability to inhibit chlamydial infection. When C. trachomatis serovar L2 organisms were pre-incubated with increasing amounts of LL-37, the infectivity was significantly decreased (Fig. 1). Using this infection assay, we titrated the 50% inhibition concentrations (IC50) for each of the 8 human antimicrobial peptides against both C. trachomatis serovar D an L2 organisms (Table 1). As a control, the IC50 of each antimicrobial peptide against Escherichia coli was also measured. We found that the 3 alpha-defensins that are mainly produced by neutrophils but not urogenital epithelial cells displayed the weakest antichlamydial activity with an IC50 of from ~60 (alpha-defensin 2 against L2) to >100 mg/ml (alphadefensin 1 against both serovars D & L2). Among the 4 betadefensins, we found that beta-defensin 3 had the strongest antichlamydial activity with an IC50 from ~7 (against L2) to ~16 mg/ml (against D) followed by beta-defensin 2 with an IC50 of ~28 (against L2) to ~70 mg/ml (against D) while the IC50s of beta-defensins 1 & 4 were >100 mg/ml against either L2 or D organisms. These observations are consistent with previous findings that human beta-defensin 3 but not betadefensin 4 was inducible in genital tract epithelial cells in response to infection [26] and human beta-defensin 3 in cervico-vaginal secretion exhibited its antimicrobial activity via multiple mechanisms. Interestingly, the strongest antichlamydial activity was found with the cathelicidin family only member LL-37 peptide with an IC50 of ~5 (against L2) and ~10 mg/ml (against D) respectively. This observation is supported by the concept that LL-37 is both produced by mucosal epithelial cells and neutrophils recruited into the mucosal tissues and plays a critical role in mucosal immunity [11,17]. As a control, all 8 antimicrobial peptides exhibited an anti-E. coli activity with an IC50 of ~18 mg/ml for LL-37 and ~0.4 to ~3 mg/ml for beta-defensins. Together, we have demonstrated that extracellular antimicrobial peptides especially LL-37 can potently inhibit chlamydial infection, suggesting that the antimicrobial peptides may play an important role in controlling chlamydial spreading by attacking the organisms exposed to extracellular environment. 3.2. CPAF blocks the antichlamydial activity of host antimicrobial peptides Since LL-37 is known to target by other bacterial proteases [25,39] and CPAF is a serine protease secreted out of the chlamydial organisms and into host cell cytoplasm, we tested whether CPAF can block the antichlamydial activity of LL-37

L. Tang et al. / Microbes and Infection 17 (2015) 402e408

405

Fig. 1. Antichlamydial activity of human antimicrobial peptide LL-37. The C. trachomatis LGV2 organisms were treated without (panel a) or with LL-37 at the concentrations of 5 (b), 30 (c) or 90 mg/ml (d) as listed on top of the figure. The organisms were then used to infect HeLa cell monolayer grown on coverslips in 24 well plates. Forty-eight hours after infection, the cultures were processed for immunofluorescence labeling with an antichlamydial organism antibody (green) and Hoechst DNA dye (blue). The number of inclusions was counted and the results were summarized in Table 1. Note that LL-37 at 5 mg/ml significantly inhibited chlamydial infection.

(Fig. 2). We found that prior incubation of LL-37 with CPAF led to a complete blockade of the LL-37 antichlamydial activity. The blockade effect was observed when 1 mg/ml of CPAF (equivalent to 0.014 mM; The molecular weight of CPAF is ~70 kDa) was mixed with 30 mg/ml of LL-37 (equivalent to 7.5 mM; The molecular weight of LL-37 is ~4 kDa). The blockade peaked when CPAF was used at a final concentration of 10 mg/ml (0.14 mM). Clearly, a CPAF molecule could block multiple molecules of LL-37, suggesting the involvement of proteolysis. Indeed, a mutant CPAF with an alanine substitution of the catalytic residue glutamic acid at the position of 558 (E558A) failed to block the antichlamydial activity of LL-37 even when CPAF(E558A) was used at a final concentration of 100 mg/ml. 3.3. CPAF selectively degrades antimicrobial peptides with an antichlamydial activity We showed above that the powerful blockade of LL-37 antichlamydial activity by CPAF might depend on CPAF's proteolytic activity. We next evaluated CPAF's ability to degrade host antimicrobial peptides (Fig. 3A). We found that Table 1 Anti-C. trachomatis and anti-E. coli activities of antimicrobial peptides. A total of 8 human antimicrobial peptides were titrated for their ability to inhibit growth of C. trachomatis serovars D and L2 and E. coli. The concentrations of antimicrobial peptides required for inhibiting 50% of microbial growth (IC50) were determined for each antimicrobial peptide against each type of organisms. The data expressed as mg/ml in the format of mean plus/minus standard deviation came from 3 to 4 independent experiments. Antimicrobial peptides (IC50, mg/ml)

C. trachomatis D

L2

Cathelicidin a-Defensins

10.45 ± 2.55 >100 72.33 ± 4.93 >100 >100 70.3 ± 7.09 15.84 ± 3.37 >100

4.62 ± 0.94 >100 60.67 ± 5.13 >100 >100 28.33 ± 9.45 6.81 ± 1.18 >100

b-Defensins

LL-37 HNP1 HNP2 HNP3 HBD1 HBD2 HBD3 HBD4

E. coli

17.5 8.97 8.18 12.27 2.91 0.46 0.42 1.23

± ± ± ± ± ± ± ±

5.4 1.86 0.95 5.19 1.3 0.33 0.15 0.06

when CPAF was incubated with antimicrobial peptides for 30 min, 0.1 mg CPAF completely degraded 0.1 mg LL-37, indicating that it only takes 30 min for every one CPAF molecule to degrade 17.5 LL-37 molecules (since the molecular weight of CPAF is 17.5 times larger than that of LL-37). However, CPAF failed to significantly degrade any other antimicrobial peptides under the same experimental condition. Since LL-37 had the strongest antichlamydial activity among all antimicrobial peptides tested (Table 1), the above observations support the concept that CPAF may selectively target host effectors with the strongest antichlamydial activity. When the incubation was extended to 2 h, portions of beta-defensins 2 & 3 as well as alpha-defensin 2 or HNP2 (human neutrophil peptide 2) but not other defensin molecules were partially degraded by 100 mg/ml of CPAF. Degradation of these three defensins by CPAF seemed to correlate with their antichlamydial activity (Table 1), which further strengthens the concept that CPAF preferentially degrades antimicrobial peptides with antichlamydial activity. When the degradation time was shortened to 10 min, 0.16 mg of CPAF degraded >50% of 0.1 mg LL-37 and 0.32 mg of CPAF completely degraded all 0.1 mg LL-37 (Fig. 3B), demonstrating the extreme efficiency and capacity of CPAF for degrading LL-37. The CPAF mediated-degradation was specific since mutant CPAF(E558A) failed to degrade any significant amounts of antimicrobial peptides under all experimental conditions tested. 4. Discussion In the current study, after confirming that human antimicrobial peptides especially the cathelicidin LL-37 possess a potent antichlamydial activity, we have provided the first experimental evidence that the C. trachomatis serine protease CPAF that is secreted into and accumulated in the cytoplasm of the infected cells at the late stage of chlamydial intracellular growth [44] can potently block the antichlamydial activity of the extracellular antimicrobial peptides by proteolytically targeting these peptides. The chlamydial ability to unleash active CPAF molecules pre-stored in the host cell cytoplasm to

406

L. Tang et al. / Microbes and Infection 17 (2015) 402e408

Fig. 2. Blocking antichlamydial activity of LL-37 by CPAF. (A) The infection conditions were the same as described in Fig. 1 legend except that the LL-37 peptide was pre-incubated without (panel b) or with wild type (WT) CPAF at the concentrations of 1 (c), 10 (d) or 100 mg/ml (e) or mutant CPAF(E558A) at 100 mg/ml (f) prior to LL-37 treatment of chlamydial organisms. Note that the C. trachomatis LGV2 infection (a) was severely inhibited by 30 mg/ml of LL-37 (b). However, this inhibition was reversed by pre-incubation of LL-37 with wild type CPAF (c to e) but not mutant CPAF (f). The images were taken at 200 amplification. (B) Both C. trachomatis serovars D (solid bar) and LGV2 (open) were used for evaluating the CPAF-mediated blockade of LL-37 antichlamydial activity as described Figs. 1 and 2A legends above. The inclusions were counted under 600 amplification for 5 random views per coverslip and the results were expressed as number of inclusions per view. The data presented came from 3 to 4 independent experiments. Note that CPAF at 10 mg/ml completely blocked the antichlamydial activity of LL-37.

rapidly confront extracellular antimicrobial peptides upon cell lysis during chlamydial spreading may represent a novel mechanism for promoting C. trachomatis ascending infection. C. trachomatis organisms can only safely stay inside the initially infected epithelial cells until the infected cells are dislodged from the epithelial tissues and flushed out of the host. Thus, to maintain longevity in the infected host, C. trachomatis organisms must be able to spread from cell to cell, which inevitably requires the organisms to expose to the extracellular environments where immune effectors such as antimicrobial peptides are readily available for attacking the chlamydial organisms. It is known that C. trachomatis-infected epithelial cells can release cytokines to both recruit inflammatory cells including neutrophils to the site of infection and activate adjacent cells to secrete more cytokines [9,38]. Neutrophils were detected underneath the C. trachomatisinfected cells and thought to help push the infected cells to dislodge from the epithelial tissue [37]. Although neutrophils may fail to phagocytose the organisms that are still hidden inside epithelial cells, neutrophils can secrete cytokines and effector molecules such as antimicrobial peptides to create a hostile extracellular environment for C. trachomatis organisms. Clearly, C. trachomatis organisms have to overcome the antichlamydial activity of extracellular effectors in order to spread from cell to cell, which is likely required for ascending infection. The question is what molecular mechanisms C. trachomatis organisms have evolved for evading the extracellular immune effectors. Many bacterial species are known to secrete various virulence factors for targeting host molecules

[12,13,18,25,32,35,39]. The intra-inclusion C. trachomatis organisms are known to secrete a serine protease designated as CPAF into host cell cytoplasm [44]. In fact, CPAF is accumulated in large quantity in the cytoplasm of the infected cells prior to lysis of the infected cells [44]. We hypothesize that the pre-stored CPAF in the host cell cytoplasm may be rapidly released to proteolytically eliminate the extracellular antimicrobial peptides upon cell lysis before the intra-inclusion organisms are exposed to the extracellular environments. This hypothesis is supported by the followings: First, CPAF selectively targets antichlamydial peptides with an antichlamydial activity. Among all 8 antimicrobial peptides tested, LL-37 displayed the strongest antichlamydial activity and was most efficiently degraded by CPAF. We found that one CPAF molecule could degrade multiple copies of LL-37 peptides within a short period of time, suggesting that CPAF molecules released from the infected cell cytoplasm have the capacity to rapidly clear a safe extracellular passage for chlamydial organisms to spread to the next target cells. The CPAF degradation of LL-37 was specific since the mutant CPAF(E558A) failed to degrade any significant amount of LL-37. Second, CPAF accumulation in the host cell cytoplasm is more obvious with productive infection [44,21], suggesting that the increased storage of CPAF in host cell cytoplasm may be aimed for targeting host extracellular effectors when the productive infection results in cell lysis. Third, mature CPAF is stable and has a long half-life [6,15,16,23], suggesting that active CPAF can survive the mucosal extracellular environments once released from the infected cells. Fourth, although CPAF was initially thought to target various intracellular

L. Tang et al. / Microbes and Infection 17 (2015) 402e408

407

hypothesis is also consistent with the previous findings that immunization of mice with CPAF can induce partial protection against chlamydial challenge infection [33] and antibodies from women urogenitally infected with C. trachomatis neutralized CPAF activity [40]. We are aware that although we have presented experimental evidence for CPAF neutralization of the antichlamydial activity of the host AMP LL-37, these in vitro observations will have to be validated in animal models, which is underway. Conflict of interest The authors declare no conflict of interest. Acknowledgment This work was funded by grants from the US National Institutes of Health to G.Z. (R01AI064537 & R01AI047997). References

Fig. 3. CPAF degradation of antimicrobial peptides. (A) Eight human antimicrobial peptides including LL-37 (panel a), a-defensin 1 or human neutrophil peptide 1 (HNP1, b), HNP2 (c), HNP3 (d), human b-defensin 1 (HBD1, e), HBD2 (f), HBD3 (g) or HBD4 (h) were each used as substrate (0.1 mg) for degradation by varying amounts of CPAF for 30 or 120 min in a total volume of 10 ml. Each mixture was loaded to the corresponding lane of a 17% SDS polyacrylamide gel for visualizing the remaining peptides via Coomassie blue staining. Note that 0.1 mg of wild type CPAF completely degraded 0.1 mg LL-37 within 30 min while 1 mg of mutant CPAF with substitution of the catalytic residue glutamic acid (E) at the position of 558 with alanine (E558A) failed to degrade any LL-37 even after 120 min incubation. The wild type CPAF also partially degraded HNP2, HBD2 & HBD3 but not other defensin molecules after 120 min incubation. (B) CPAF was 2 fold serially diluted for further titrating its ability to degrade LL-37. The wild type CPAF at 0.16 mg degraded >50% while at 0.32 mg degraded all of the 0.1 mg LL-37 within 10 min. The inactive mutant CPAF and active CPAF Nterminal (CPAFn) and C-terminal (CPAFc) fragments as well as residual antimicrobial peptides visualized with the Coomassie blue dye were marked on the right of the figure. Partial or complete degradation of antimicrobial peptides was marked with single or double stars respectively.

molecules, a recent report demonstrated that CPAF degradation of intracellular molecules might occur during sample processing [4], suggesting that the authentic substrates of CPAF may lie elsewhere, including immune effectors in the extracellular environment. This assumption is consistent with the fact that CPAF is a late expression gene and the protein is accumulated in the late stage of chlamydial intracellular infection. Proteins encoded by late genes are thought to benefit the next infection cycle. Thus, CPAF may play a role in promoting chlamydial cell-to-cell spreading. Finally, this

[1] Anaya-Lopez JL, Lopez-Meza JE, Ochoa-Zarzosa A. Bacterial resistance to cationic antimicrobial peptides. Crit Rev Microbiol 2012;39:180e95. [2] Betts-Hampikian HJ, Fields KA. The chlamydial type III secretion mechanism: revealing cracks in a tough nut. Front Microbiol 2010;1:114. [3] Centers for Disease Control and Prevention C. Sexually transmitted disease surveillance, 2008. Atlanta, GA: USDoHaH Services; November 2009. http://www.cdc.gov/std/stats08/toc.htm. [4] Chen AL, Johnson KA, Lee JK, Su¨tterlin C, Tan M. CPAF: a chlamydial protease in search of an authentic substrate. PLoS Pathog 2012;8:e1002842. [5] Chen D, Chai J, Hart PJ, Zhong G. Identifying catalytic residues in CPAF, a Chlamydia-secreted protease. Arch Biochem Biophys 2009;485:16e23. [6] Chen D, Lei L, Flores R, Huang Z, Wu Z, Chai J, et al. Autoprocessing and self-activation of the secreted protease CPAF in Chlamydia-infected cells. Microb Pathog 2010;49:164e73. [7] Chen D, Lei L, Lu C, Galaleldeen A, Hart PJ, Zhong G. Characterization of Pgp3, a Chlamydia trachomatis plasmid-encoded immunodominant antigen. J Bacteriol 2010;192:6017e24. [8] Cheng W, Shivshankar P, Li Z, Chen L, Yeh IT, Zhong G. Caspase-1 contributes to Chlamydia trachomatis-induced upper urogenital tract inflammatory pathologies without affecting the course of infection. Infect Immun 2008;76:515e22. [9] Cheng W, Shivshankar P, Zhong Y, Chen D, Li Z, Zhong G. Intracellular interleukin-1alpha mediates interleukin-8 production induced by Chlamydia trachomatis infection via a mechanism independent of type I interleukin-1 receptor. Infect Immun 2008;76:942e51. [10] Choi KY, Chow LN, Mookherjee N. Cationic host defence peptides: multifaceted role in immune modulation and inflammation. J Innate Immun 2012;4:361e70. [11] Chromek M, Slamova Z, Bergman P, Kovacs L, Podracka L, Ehren I, et al. The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection. Nat Med 2006;12:636e41. [12] Diacovich L, Gorvel JP. Bacterial manipulation of innate immunity to promote infection. Nat Rev Microbiol 2010;8:117e28. [13] Donato GM, Goldsmith CS, Paddock CD, Eby JC, Gray MC, Hewlett EL. Delivery of Bordetella pertussis adenylate cyclase toxin to target cells via outer membrane vesicles. FEBS Lett 2012;586:459e65. [14] Dong F, Flores R, Chen D, Luo J, Zhong Y, Wu Z, et al. Localization of the hypothetical protein Cpn0797 in the cytoplasm of Chlamydia pneumoniae-infected host cells. Infect Immun 2006;74:6479e86. [15] Dong F, Pirbhai M, Zhong Y, Zhong G. Cleavage-dependent activation of a Chlamydia-secreted protease. Mol Microbiol 2004;52:1487e94.

408

L. Tang et al. / Microbes and Infection 17 (2015) 402e408

[16] Dong F, Sharma J, Xiao Y, Zhong Y, Zhong G. Intramolecular dimerization is required for the Chlamydia-secreted protease CPAF to degrade host transcriptional factors. Infect Immun 2004;72:3869e75. [17] Doss M, White MR, Tecle T, Hartshorn KL. Human defensins and LL-37 in mucosal immunity. J Leukoc Biol 2010;87:79e92. [18] Elmi A, Watson E, Sandu P, Gundogdu O, Mills DC, Inglis NF, et al. Campylobacter jejuni outer membrane vesicles play an important role in bacterial interactions with human intestinal epithelial cells. Infect Immun 2012;80:4089e98. [19] Fan T, Lu H, Hu H, Shi L, McClarty GA, Nance DM, et al. Inhibition of apoptosis in Chlamydia-infected cells: blockade of mitochondrial cytochrome c release and caspase activation. J Exp Med 1998;187:487e96. [20] Gallo RL, Hooper LV. Epithelial antimicrobial defence of the skin and intestine. Nat Rev Immunol 2012;12:503e16. [21] Heuer D, Brinkmann V, Meyer TF, Szczepek AJ. Expression and translocation of chlamydial protease during acute and persistent infection of the epithelial HEp-2 cells with Chlamydophila (Chlamydia) pneumoniae. Cell Microbiol 2003;5:315e22. [22] Horne AW, Stock SJ, King AE. Innate immunity and disorders of the female reproductive tract. Reproduction 2008;135:739e49. [23] Huang Z, Feng Y, Chen D, Wu X, Huang S, Wang X, et al. Structural basis for activation and inhibition of the secreted Chlamydia protease CPAF. Cell Host Microbe 2008;4:529e42. [24] Hybiske K, Stephens RS. Mechanisms of host cell exit by the intracellular bacterium Chlamydia. Proc Natl Acad Sci U. S. A. 2007;104:11430e5. [25] Karlsson C, Andersson ML, Collin M, Schmidtchen A, Bjorck L, Frick IM. SufA e a novel subtilisin-like serine proteinase of Finegoldia magna. Microbiology 2007;153:4208e18. [26] King AE, Fleming DC, Critchley HO, Kelly RW. Differential expression of the natural antimicrobials, beta-defensins 3 and 4, in human endometrium. J Reprod Immunol 2003;59:1e16. [27] Korting HC, Schollmann C, Stauss-Grabo M, Schafer-Korting M. Antimicrobial peptides and skin: a paradigm of translational medicine. Skin Pharmacol Physiol 2012;25:323e34. [28] Kosciuczuk EM, Lisowski P, Jarczak J, Strzalkowska N, Jozwik A, Horbanczuk J, et al. Cathelicidins: family of antimicrobial peptides. A review. Mol Biol Rep 2012;39:10957e70. [29] Land JA, Van Bergen JE, Morre SA, Postma MJ. Epidemiology of Chlamydia trachomatis infection in women and the cost-effectiveness of screening. Hum Reprod Update 2010;16:189e204. [30] Lei L, Qi M, Budrys N, Schenken R, Zhong G. Localization of Chlamydia trachomatis hypothetical protein CT311 in host cell cytoplasm. Microb Pathog 2011;51:101e9. [31] Li Z, Chen D, Zhong Y, Wang S, Zhong G. The chlamydial plasmidencoded protein pgp3 is secreted into the cytosol of Chlamydia-infected cells. Infect Immun 2008;76:3415e28. [32] Lindmark B, Rompikuntal PK, Vaitkevicius K, Song T, Mizunoe Y, Uhlin BE, et al. Outer membrane vesicle-mediated release of cytolethal

[33]

[34]

[35] [36]

[37]

[38]

[39]

[40]

[41] [42]

[43] [44]

[45]

[46]

distending toxin (CDT) from Campylobacter jejuni. BMC Microbiol 2009;9:220. Murthy AK, Cong Y, Murphey C, Guentzel MN, Forsthuber TG, Zhong G, et al. Chlamydial protease-like activity factor induces protective immunity against genital chlamydial infection in transgenic mice that express the human HLA-DR4 allele. Infect Immun 2006;74:6722e9. Porter E, Yang H, Yavagal S, Preza GC, Murillo O, Lima H, et al. Distinct defensin profiles in Neisseria gonorrhoeae and Chlamydia trachomatis urethritis reveal novel epithelial cell-neutrophil interactions. Infect Immun 2005;73:4823e33. Potempa J, Pike RN. Corruption of innate immunity by bacterial proteases. J Innate Immun 2009;1:70e87. Qi M, Lei L, Gong S, Liu Q, Delisa M, Zhong G. Chlamydia trachomatis secretion of an immunodominant hypothetical protein (CT795) into host cell cytoplasm. J Bacteriol 2011;193:2498e508. Rank RG, Whittimore J, Bowlin AK, Wyrick PB. In vivo ultrastructural analysis of the intimate relationship between polymorphonuclear leukocytes and the chlamydial developmental cycle. Infect Immun 2011;79:3291e301. Rasmussen SJ, Eckmann L, Quayle AJ, Shen L, Zhang YX, Anderson DJ, et al. Secretion of proinflammatory cytokines by epithelial cells in response to Chlamydia infection suggests a central role for epithelial cells in chlamydial pathogenesis. J Clin Invest 1997;99:77e87. Schmidtchen A, Frick IM, Andersson E, Tapper H, Bjorck L. Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol Microbiol 2002;46:157e68. Sharma J, Dong F, Pirbhai M, Zhong G. Inhibition of proteolytic activity of a chlamydial proteasome/protease-like activity factor by antibodies from humans infected with Chlamydia trachomatis. Infect Immun 2005;73:4414e9. Stephens RS. The cellular paradigm of chlamydial pathogenesis. Trends Microbiol 2003;11:44e51. Wu X, Lei L, Gong S, Chen D, Flores R, Zhong G. The chlamydial periplasmic stress response serine protease cHtrA is secreted into host cell cytosol. BMC Microbiol 2011;11:87. Zhong G. Killing me softly: chlamydial use of proteolysis for evading host defenses. Trends Microbiol 2009;17:467e74. Zhong G, Fan P, Ji H, Dong F, Huang Y. Identification of a chlamydial protease-like activity factor responsible for the degradation of host transcription factors. J Exp Med 2001;193:935e42. Zhong G, Fan T, Liu L. Chlamydia inhibits interferon gamma-inducible major histocompatibility complex class II expression by degradation of upstream stimulatory factor 1. J Exp Med 1999;189:1931e8. Zhong G, Liu L, Fan T, Fan P, Ji H. Degradation of transcription factor RFX5 during the inhibition of both constitutive and interferon gammainducible major histocompatibility complex class I expression in Chlamydia-infected cells. J Exp Med 2000;191:1525e34.